Manfaat Melilea Organic Soya Drink

Melilea Organic Soya Drink mengandung:

1. Protein Tumbuhan :

• Setiap 100g Melilea Organic Soya Drink mengandung 23g protein

• Mengandung 22 jenis Asam Amino termasuk asam amino yang dibutuhkan

• Omega 6 & Omega 3

• Protein Digestibility Amino Acid Score (PDCAAS) =1.0


2. Isoflavon :

Sejenis phytonutrien yang strukturnya sama dengan struktur estrogen.


o Fungsi-fungsi Isoflavones

• Melawan Kanker terutama kanker prostat, payudara, uterus, dan usus

• Mengurangi Kolesterol

• Meningkatkan HDL dan mengurangi LDL

• Mengurangi gejala menopause


3. Bahan Mineral :

Mineral : Kalsium, Magnesium, zat besi, Potassium, Fosforus, Selenium dan Zink. 

Kalsium membantu kita meningkatkan kekuatan tulang serta dapat mencegah Osteoporosis


Selenium ialah antioxidan yang membantu kita mengoksidakan lemak dari sel badan


4. Lesitin :

o Menurunkan LDL

o Mengurangi resiko serangan jantung, tekanan darah tinggi

o Menguatkan sel tubuh

o Membantu dalam perkembangan sel otak


5. Saponin:

  • Mengurangi pengumpulan radikal bebas yang menyebabkan resiko kanker
  • Sumber protein nabati yang terbaik
  • Meningkatkan metabolisme tubuh
  • Menguatkan sistem imun tubuh
  • Menstabilkan kadar gula darah
  • Melindungi jantung
  • Menambah daya ingat
  • Membentuk tulang yang kuat
  • Menurunkan resiko sakit jantung
  • Menurunkan tekanan darah dan kolesterol
  • Mencegah menopause bagi wanita
  • Menurunkan resiko kanker payudara
  • Menurunkan resiko kanker prostat
  • Mengurangi resiko serangan jantung dan stroke
  • Menghasilkan tenaga dan meningkatkan kesehatan

4 Responses to “Manfaat Melilea Organic Soya Drink”

  1. rafii Says:

    semoga produk by melilea tetap organik dan susu soya bean kacang kedelai melilea tetap aman dan terbebas dari pencemaran melamin yang mematikan.
    BPOM RI : usaha dan kerja keras untuk kepentingan bersama. semoga sukses B-)

  2. rafii Says:

    Susu soya melilea terlaris di jual karena harganya terjangkau untuk semua kalangan.

  3. rafiiminkalampanganpalangkaraya Says:

    Melilea organic dapat menambah stamina tubuh, menyembuhkan sakit pinggang dan sakit kepala akibat tekanan. Salam melilea to all members and good luck.

  4. 4lifetransferfactorindonesia Says:

    Mau berbagi Info nih…..

    Kenapa dalam satu keluarga yang pola hidup, pola makan dan lingkungannya sama, namun bisa ada yang mudah sakit sementara yang lain tidak? Ada yang mudah kena penyakit seperti flu atau demam dan cepat sembuh, tapi ada pula yang lama sembuhnya.

    Apakah penyebabnya ?….

    Kesehatan kita dipengaruhi langsung oleh sistem imun. Sistem imun adalah sistem pertahanan tubuh terhadap penyakit yang terdiri lebih dari triliyunan sel-sel NK ( Natural Killer), yang jumlah berat totalnya kira-kira 1 kg
    (2,2 pons).

    Apa Itu sel NK ?…

    Sel NK (Natural Killer) adalah sel imun yang bertanggung jawab mencari dan memusnahkan sel-sel “jahat” asing yang tidak dikenali oleh tubuh, termasuk sel kanker dan sel yang terinfeksi serangan virus, bakteri, dll. Jika seseorang memiliki aktivitas sel NK kurang dari 20% maka akan beresiko mudah terserang penyakit atau kurang kekebalan tubuh dalam upaya sembuh dari penyakit.

    Dari penelitian, Transfer Factor [ TF ] yang diekstrak dari kolostrum dengan teknologi Nano Factor mampu meningkatkan aktivitas sel NK sebanyak 103%. dan campuran TF dengan bahan-bahan alami lain yang berada pada 6 tingkat pertama daftar bahan awal induk mampu meningkatkan sel-sel NK menjadi 283%-437%. Perlu diingat, TF sendiri bukan obat, namun TF akan melatih / mendidik dan merangsang sistem kekebalan tubuh seseorang untuk melawan dan mengatasi penyakit tersebut.

    Blog :

    Ryan & Kenny

Leave a Reply

Fill in your details below or click an icon to log in: Logo

You are commenting using your account. Log Out / Change )

Twitter picture

You are commenting using your Twitter account. Log Out / Change )

Facebook photo

You are commenting using your Facebook account. Log Out / Change )

Google+ photo

You are commenting using your Google+ account. Log Out / Change )

Connecting to %s

%d bloggers like this: